PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02179.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 348aa    MW: 40310 Da    PI: 7.5659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02179.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-1694139147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
  Rsa1.0_02179.1_g00001.1  94 RGHWRPAEDMKLKELVAIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 139
                              899*****************************.***********996 PP

2Myb_DNA-binding57.33.6e-18146189146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r ++T++E+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
  Rsa1.0_02179.1_g00001.1 146 RRAFTEDEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 189
                              678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.28289140IPR017930Myb domain
SMARTSM007172.0E-1493142IPR001005SANT/Myb domain
SuperFamilySSF466891.76E-2894187IPR009057Homeodomain-like
PfamPF002494.2E-1694139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2695147IPR009057Homeodomain-like
CDDcd001671.35E-1297138No hitNo description
PROSITE profilePS5129427.162141195IPR017930Myb domain
SMARTSM007171.6E-14145193IPR001005SANT/Myb domain
PfamPF002494.7E-15146188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-21148194IPR009057Homeodomain-like
CDDcd001675.35E-11148188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MFISGNQRRK DEVAAARREA SSWDFPFNDI NVQHHRRCNI SHEFDILKSP LGDNVEESNN  60
HNPLYSNNES GKKETTDSGQ SWSSSSSKPS VLGRGHWRPA EDMKLKELVA IYGPQNWNLI  120
AEKLQGRSGK SCRLRWFNQL DPRINRRAFT EDEEERLMQA HRLYGNKWAM IARLFPGRTD  180
NSVKNHWHVI MARKYREHSS AYRRRKLMIN NPLKPHLPNP NPNYHSFIST HHYFTQPIHE  240
LNFTHHMVNN ASITPDHNQL VLPINCFQGY ESNENPMVVS MFGNQIMGRD NVGAMSEGLY  300
DFPYIDSTSH EKGVSNEPMS WIGMEGEDEE EKAKQQPQFF DFLGLGTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-31911941104C-Myb DNA-Binding Domain
1mse_C2e-31911941104C-Myb DNA-Binding Domain
1gv2_A2e-31921942104MYB PROTO-ONCOGENE PROTEIN
1a5j_A2e-31921945107B-MYB
1h89_C8e-319219456158MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-319219456158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110033.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A078IAW00.0A0A078IAW0_BRANA; BnaA08g19860D protein
TrEMBLM4DIF80.0M4DIF8_BRARP; Uncharacterized protein
STRINGBra016285.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.21e-171myb domain protein 117